Recombinant Human Creatine Kinase, Muscle/CKMM Protein

Order Details


    • Catalog Number
      H00001158-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Creatine Kinase, Muscle/CKMM Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CKM partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Protein/Peptide Type
Partial Recombinant Protein
Gene
CKM

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Creatine Kinase, Muscle/CKMM Protein

  • CKM
  • CKMM
  • CKMMcreatine kinase M-type
  • Creatine kinase M chain
  • Creatine Kinase MM
  • creatine kinase, muscle
  • creatine kinase-M
  • EC 2.7.3
  • EC 2.7.3.2
  • M-CK

Background

CKM - creatine kinase, muscle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB6967
Species: Hu
Applications: WB
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15356
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54661
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01) (0)

There are no publications for Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01) (0)

There are no reviews for Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Creatine Kinase, Muscle/CKMM Products

Bioinformatics Tool for Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01)

Discover related pathways, diseases and genes to Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01)

Discover more about diseases related to Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01).
 

Pathways for Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01)

View related products by pathway.

PTMs for Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01)

Learn more about PTMs related to Creatine Kinase, Muscle/CKMM Partial Recombinant Protein (H00001158-Q01).

Blogs on Creatine Kinase, Muscle/CKMM

There are no specific blogs for Creatine Kinase, Muscle/CKMM, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Creatine Kinase, Muscle/CKMM Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CKM
Entrez