Creatine Kinase, Muscle/CKMM Antibody

Images

 
Western Blot: Creatine Kinase, Muscle/CKMM Antibody [NBP1-52863] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Creatine Kinase, Muscle/CKMM Antibody Summary

Immunogen
Synthetic peptides corresponding to CKM(creatine kinase, muscle) The peptide sequence was selected from the N terminal of CKM. Peptide sequence VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CKM and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Creatine Kinase, Muscle/CKMM Antibody

  • CKM
  • CKMM
  • CKMMcreatine kinase M-type
  • Creatine kinase M chain
  • Creatine Kinase MM
  • creatine kinase, muscle
  • creatine kinase-M
  • EC 2.7.3
  • EC 2.7.3.2
  • M-CK

Background

CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. CKM is a member of the ATP: guanido phosphotransferase protein family.The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75446
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15356
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Po, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-83790
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54661
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Op, Pm
Applications: WB, IHC-P
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863) (0)

There are no publications for Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863) (0)

There are no reviews for Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Creatine Kinase, Muscle/CKMM Products

Bioinformatics Tool for Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863)

Discover related pathways, diseases and genes to Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863)

Discover more about diseases related to Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863).
 

Pathways for Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863)

View related products by pathway.

PTMs for Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863)

Learn more about PTMs related to Creatine Kinase, Muscle/CKMM Antibody (NBP1-52863).

Blogs on Creatine Kinase, Muscle/CKMM

There are no specific blogs for Creatine Kinase, Muscle/CKMM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Creatine Kinase, Muscle/CKMM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CKM
Uniprot