Creatine Kinase B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Creatine Kinase B Antibody [NBP1-84460] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.
Immunohistochemistry-Paraffin: Creatine Kinase B Antibody [NBP1-84460] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in a subset of glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Creatine Kinase B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Creatine Kinase B Protein (NBP1-84460PEP)
Publications
Read Publications using
NBP1-84460 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Creatine Kinase B Antibody

  • B-CK
  • Creatine kinase B chain
  • creatine kinase, brain
  • creatine kinase-B
  • EC 2.7.3
  • EC 2.7.3.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5564
Species: Hu
Applications: WB, Simple Western
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-31543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13840
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84460
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Creatine Kinase B Antibody (NBP1-84460)(3)

Reviews for Creatine Kinase B Antibody (NBP1-84460) (0)

There are no reviews for Creatine Kinase B Antibody (NBP1-84460). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Creatine Kinase B Antibody (NBP1-84460) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Creatine Kinase B Products

Bioinformatics Tool for Creatine Kinase B Antibody (NBP1-84460)

Discover related pathways, diseases and genes to Creatine Kinase B Antibody (NBP1-84460). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Creatine Kinase B Antibody (NBP1-84460)

Discover more about diseases related to Creatine Kinase B Antibody (NBP1-84460).
 

Pathways for Creatine Kinase B Antibody (NBP1-84460)

View related products by pathway.

PTMs for Creatine Kinase B Antibody (NBP1-84460)

Learn more about PTMs related to Creatine Kinase B Antibody (NBP1-84460).

Blogs on Creatine Kinase B

There are no specific blogs for Creatine Kinase B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Creatine Kinase B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CKB
Entrez
Uniprot