Creatine Kinase B Antibody (3D5-3D11)

Images

 
Immunocytochemistry/ Immunofluorescence: Creatine Kinase B Antibody (3D5-3D11) [H00001152-M01] - Analysis of monoclonal antibody to CKB on HeLa cell. Antibody concentration 30 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3D5-3D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Creatine Kinase B Antibody (3D5-3D11) Summary

Immunogen
CKB (AAH01190, 1 a.a. - 381 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Specificity
CKB - creatine kinase, brain
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CKB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Creatine Kinase B Antibody (3D5-3D11)

  • B-CK
  • Creatine kinase B chain
  • creatine kinase, brain
  • creatine kinase-B
  • EC 2.7.3
  • EC 2.7.3.2

Background

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5564
Species: Hu
Applications: WB, Simple Western
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-31543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13840
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00001152-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Creatine Kinase B Antibody (H00001152-M01) (0)

There are no publications for Creatine Kinase B Antibody (H00001152-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Creatine Kinase B Antibody (H00001152-M01) (0)

There are no reviews for Creatine Kinase B Antibody (H00001152-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Creatine Kinase B Antibody (H00001152-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Creatine Kinase B Products

Bioinformatics Tool for Creatine Kinase B Antibody (H00001152-M01)

Discover related pathways, diseases and genes to Creatine Kinase B Antibody (H00001152-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Creatine Kinase B Antibody (H00001152-M01)

Discover more about diseases related to Creatine Kinase B Antibody (H00001152-M01).
 

Pathways for Creatine Kinase B Antibody (H00001152-M01)

View related products by pathway.

PTMs for Creatine Kinase B Antibody (H00001152-M01)

Learn more about PTMs related to Creatine Kinase B Antibody (H00001152-M01).
 

Research Areas for Creatine Kinase B Antibody (H00001152-M01)

Find related products by research area.

Blogs on Creatine Kinase B

There are no specific blogs for Creatine Kinase B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Creatine Kinase B Antibody (3D5-3D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CKB
Entrez
OMIM
Uniprot