CRABP2 Antibody (4F2)

Images

 
Western Blot: CRABP2 Antibody (4F2) [H00001382-M01] - Analysis of CRABP2 expression in transfected 293T cell line by CRABP2 monoclonal antibody (M01), clone 4F2.Lane 1: CRABP2 transfected lysate(15.7 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: CRABP2 Antibody (4F2) [H00001382-M01] - Analysis of monoclonal antibody to CRABP2 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: CRABP2 Antibody (4F2) [H00001382-M01] - Detection limit for recombinant GST tagged CRABP2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRABP2 Antibody (4F2) Summary

Immunogen
CRABP2 (NP_001869.1, 1 a.a. - 138 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRABP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRABP2 Antibody (4F2)

  • cellular retinoic acid binding protein 2
  • Cellular retinoic acid-binding protein II
  • CRABP2
  • CRABP-II
  • CRABP-IIcellular retinoic acid-binding protein 2
  • RBP6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-58922
Species: Hu
Applications: WB
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
H00056603-M01
Species: Hu
Applications: WB, ELISA

Publications for CRABP2 Antibody (H00001382-M01) (0)

There are no publications for CRABP2 Antibody (H00001382-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRABP2 Antibody (H00001382-M01) (0)

There are no reviews for CRABP2 Antibody (H00001382-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CRABP2 Antibody (H00001382-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRABP2 Products

Bioinformatics Tool for CRABP2 Antibody (H00001382-M01)

Discover related pathways, diseases and genes to CRABP2 Antibody (H00001382-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRABP2 Antibody (H00001382-M01)

Discover more about diseases related to CRABP2 Antibody (H00001382-M01).
 

Pathways for CRABP2 Antibody (H00001382-M01)

View related products by pathway.

PTMs for CRABP2 Antibody (H00001382-M01)

Learn more about PTMs related to CRABP2 Antibody (H00001382-M01).
 

Research Areas for CRABP2 Antibody (H00001382-M01)

Find related products by research area.

Blogs on CRABP2

There are no specific blogs for CRABP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRABP2 Antibody (4F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRABP2
Entrez
Uniprot