CPEB1 Antibody

Images

 
Western Blot: CPEB1 Antibody [NBP2-32350] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry: CPEB1 Antibody [NBP2-32350] - Staining of breast cancer.
Immunohistochemistry: CPEB1 Antibody [NBP2-32350] - Staining of human urinary bladder shows strong membranous and cytoplasmic positivity in urothelial cells.
Immunohistochemistry: CPEB1 Antibody [NBP2-32350] - Staining of placenta.

Product Details

Summary
Product Discontinued
View other related CPEB1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-32350
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CPEB1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CPEB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunohistochemistry 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CPEB1 Antibody

  • CPEBCEBP
  • CPE-binding protein 1
  • CPE-BP1
  • cytoplasmic polyadenylation element binding protein 1
  • cytoplasmic polyadenylation element-binding protein 1
  • FLJ13203
  • h-CEBP
  • hCPEB-1
  • MGC34136
  • MGC60106

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58551
Species: Hu
Applications: WB, ICC/IF
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56919
Species: Hu
Applications: WB
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-15984
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for CPEB1 Antibody (NBP2-32350) (0)

There are no publications for CPEB1 Antibody (NBP2-32350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPEB1 Antibody (NBP2-32350) (0)

There are no reviews for CPEB1 Antibody (NBP2-32350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CPEB1 Antibody (NBP2-32350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CPEB1 Products

Bioinformatics Tool for CPEB1 Antibody (NBP2-32350)

Discover related pathways, diseases and genes to CPEB1 Antibody (NBP2-32350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPEB1 Antibody (NBP2-32350)

Discover more about diseases related to CPEB1 Antibody (NBP2-32350).
 

Pathways for CPEB1 Antibody (NBP2-32350)

View related products by pathway.

PTMs for CPEB1 Antibody (NBP2-32350)

Learn more about PTMs related to CPEB1 Antibody (NBP2-32350).
 

Research Areas for CPEB1 Antibody (NBP2-32350)

Find related products by research area.

Blogs on CPEB1

There are no specific blogs for CPEB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CPEB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CPEB1