CPA3 Antibody



Product Details

Product Discontinued
View other related CPA3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CPA3 Antibody Summary

Synthetic peptides corresponding to Cpa3 (carboxypeptidase A3, mast cell) The peptide sequence was selected from the N terminal of Cpa3. Peptide sequence ILIHDLQEEIEKQFDVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against Cpa3 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
36 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


The function of Cpa3 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Mu
Applications: WB

Publications for CPA3 Antibody (NBP1-69069) (0)

There are no publications for CPA3 Antibody (NBP1-69069).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CPA3 Antibody (NBP1-69069) (0)

There are no reviews for CPA3 Antibody (NBP1-69069). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for CPA3 Antibody (NBP1-69069) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CPA3 Antibody Products

Related Products by Gene

Bioinformatics Tool for CPA3 Antibody (NBP1-69069)

Discover related pathways, diseases and genes to CPA3 Antibody (NBP1-69069). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CPA3 Antibody (NBP1-69069)

Discover more about diseases related to CPA3 Antibody (NBP1-69069).

Pathways for CPA3 Antibody (NBP1-69069)

View related products by pathway.

PTMs for CPA3 Antibody (NBP1-69069)

Learn more about PTMs related to CPA3 Antibody (NBP1-69069).

Blogs on CPA3

There are no specific blogs for CPA3, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol CPA3

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69069 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.