COX4 Antibody (4A10)

Images

 
Western Blot: COX4 Antibody (4A10) [H00001327-M08] - Western Blot analysis of COX4I1 expression in transfected 293T cell line by COX4I1 monoclonal antibody (M08), clone 4A10. Lane 1: COX4I1 transfected lysate (19.6 ...read more
Immunohistochemistry-Paraffin: COX4 Antibody (4A10) [H00001327-M08] - Analysis of monoclonal antibody to COX4I1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml
Sandwich ELISA: COX4 Antibody (4A10) [H00001327-M08] - Detection limit for recombinant GST tagged COX4I1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

COX4 Antibody (4A10) Summary

Immunogen
COX4I1 (AAH08704, 1 a.a. - 169 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Marker
Mitochondria Marker
Specificity
COX4I1 - cytochrome c oxidase subunit IV isoform 1 (4A10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
COX4I1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for COX4 Antibody (4A10)

  • COX IV-1
  • COX4
  • COX4-1
  • COX4COXIV
  • COX4I2
  • Cytochrome c oxidase polypeptide IV
  • cytochrome c oxidase subunit 4 isoform 1, mitochondrial
  • cytochrome c oxidase subunit IV isoform 1cytochrome c oxidase subunit IV
  • MGC72016

Background

Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30764
Species: Hu
Applications: IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00084701-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89499
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00001327-M08
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for COX4 Antibody (H00001327-M08) (0)

There are no publications for COX4 Antibody (H00001327-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX4 Antibody (H00001327-M08) (0)

There are no reviews for COX4 Antibody (H00001327-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX4 Antibody (H00001327-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COX4 Products

Bioinformatics Tool for COX4 Antibody (H00001327-M08)

Discover related pathways, diseases and genes to COX4 Antibody (H00001327-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX4 Antibody (H00001327-M08)

Discover more about diseases related to COX4 Antibody (H00001327-M08).
 

Pathways for COX4 Antibody (H00001327-M08)

View related products by pathway.

PTMs for COX4 Antibody (H00001327-M08)

Learn more about PTMs related to COX4 Antibody (H00001327-M08).
 

Research Areas for COX4 Antibody (H00001327-M08)

Find related products by research area.

Blogs on COX4.

The Importance of the COX IV Antibody to Apoptosis Research
COX IV isoform 1 is a nuclear-encoded polypeptide chain of the Cytochrome C Oxidase enzyme, located on the mitochondrial inner membrane. Owing to its widespread distribution in human and mammalian tissues, COX IV antibodies are widely used as loading...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COX4 Antibody (4A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol COX4I1
Entrez
Uniprot