COX-2 Recombinant Protein Antigen

Images

 
There are currently no images for COX-2 Protein (NBP1-85499PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

COX-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PTGS2.

Source: E. coli

Amino Acid Sequence: RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTGS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85499.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COX-2 Recombinant Protein Antigen

  • COX2
  • COX-2
  • COX2cyclooxygenase 2b
  • cyclooxygenase-2
  • EC 1.14.99
  • EC 1.14.99.1
  • GRIPGHS
  • hCox-2
  • PGG/HS
  • PGH synthase 2
  • PGHS-2
  • PHS II
  • PHS-2
  • PHS-II
  • prostaglandin G/H synthase 2
  • prostaglandin G/H synthase and cyclooxygenase
  • Prostaglandin H2 synthase 2
  • prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase andcyclooxygenase)
  • Prostaglandin-endoperoxide synthase 2
  • PTGS2

Background

COX2 (Cyclooxygenase 2) is an inducible enzyme. It is involved in the response of cells to growth factors, tumor promoters, and cytokines that induce its expression. Given its role in synthesizing prostaglandins, COX2 is therefore of interest in studying immune response regulation. COX2 is induced by a wide variety of stimuli and was initially identified as immediate early growth response gene. In addition, COX2 expression markedly increased in 85-90% of human colorectal adenocarcinoma whereas COX1 levels remain unchanged.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-85500
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85499PEP
Species: Hu
Applications: AC

Publications for COX-2 Protein (NBP1-85499PEP) (0)

There are no publications for COX-2 Protein (NBP1-85499PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX-2 Protein (NBP1-85499PEP) (0)

There are no reviews for COX-2 Protein (NBP1-85499PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COX-2 Protein (NBP1-85499PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COX-2 Products

Research Areas for COX-2 Protein (NBP1-85499PEP)

Find related products by research area.

Blogs on COX-2.

Immune Cell Metabolic Flux Influences Type I Diabetes
By Hunter MartinezWhat is Immunometabolism?It is well established that abnormal metabolic environments can be a risk factor for disease development. One characteristic example is the role of dyslipidemia (high lev...  Read full blog post.

Increased wild type FUS levels in ALS patients lead to a toxic microenvironment and motor neuron neurodegeneration
By Michalina Hanzel, PhDFUS mutations in Amyotrophic Lateral SclerosisFused in sarcoma (FUS) is a ribonucleoprotein that continuously shuttles between the nucleus and the cytoplasm to regulate pre-mRNA splicing, mRN...  Read full blog post.

SUCNR1/GPR91 - a potential role in renovascular hypertension
SUCNR1 is the cognate receptor for the Kreb's citric acid cycle intermediate succinate. It is of interest to scientists because it is involved in not only energy metabolism but possibly also in renovascular hypertension, a condition linked to diabe...  Read full blog post.

Inhibitor kappa B-alpha (IkappaB-alpha)
The transcription factor nuclear factor kappa beta (NFkB) is highly regulated by triggers such as stress, free-radicals, UV light, and hypoxia. NFkB is one of the fastest responding transcription factors in humans. The NFKB signaling pathway is ess...  Read full blog post.

Customers Who Bought This Also Bought

COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COX-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGS2