COX-1 Antibody


Western Blot: COX1 Antibody [NBP1-60098] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related COX-1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

COX-1 Antibody Summary

Synthetic peptides corresponding to COX1 (cytochrome c oxidase I) The peptide sequence was selected from the C terminal of COX1. Peptide sequence FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against COX1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for COX-1 Antibody

  • COX1
  • COX-1
  • COX3
  • cyclooxygenase-1
  • EC
  • PCOX1
  • PGH synthase 1
  • PGHS1
  • PGHS-1PHS1
  • PHS 1
  • prostaglandin G/H synthase 1
  • prostaglandin G/H synthase and cyclooxygenase
  • Prostaglandin H2 synthase 1
  • prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase andcyclooxygenase)
  • Prostaglandin-endoperoxide synthase 1
  • PTGS1


COX3 is a multi-pass membrane protein. It belongs to the cytochrome c oxidase subunit 3 family. Defects in COX3 are a cause of Leber hereditary optic neuropathy (LHON) and cytochrome c oxidase deficiency (COX deficiency). Defects in MT-CO3 are also found in mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes (MELAS) syndrome and recurrent myoglobinuria.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for COX-1 Antibody (NBP1-60098) (0)

There are no publications for COX-1 Antibody (NBP1-60098).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COX-1 Antibody (NBP1-60098) (0)

There are no reviews for COX-1 Antibody (NBP1-60098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COX-1 Antibody (NBP1-60098). (Showing 1 - 1 of 1 FAQ).

  1. Please could you tell me if Novus Biologicals has an active COX1 Recombinant Protein?
    • Unfortunately we do not currently have any COX1 recombinant proteins that are expected to be active.

Secondary Antibodies


Isotype Controls

Additional COX-1 Products

Bioinformatics Tool for COX-1 Antibody (NBP1-60098)

Discover related pathways, diseases and genes to COX-1 Antibody (NBP1-60098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COX-1 Antibody (NBP1-60098)

Discover more about diseases related to COX-1 Antibody (NBP1-60098).

Pathways for COX-1 Antibody (NBP1-60098)

View related products by pathway.

PTMs for COX-1 Antibody (NBP1-60098)

Learn more about PTMs related to COX-1 Antibody (NBP1-60098).

Blogs on COX-1

There are no specific blogs for COX-1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our COX-1 Antibody and receive a gift card or discount.


Gene Symbol PTGS1