Recombinant Human Contactin-4 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Contactin-4 Peptides and Proteins

Order Details


    • Catalog Number
      H00152330-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Contactin-4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 800 - 898 of Human CNTN4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CNTN4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Contactin-4 Protein

  • AXCAM
  • axonal-associated cell adhesion molecule
  • BIG-2
  • BIG-2Brain-derived immunoglobulin superfamily protein 2
  • CNTN4
  • contactin 4
  • Contactin4
  • Contactin-4
  • MGC33615
  • neural cell adhesion protein BIG-2

Background

The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
AF5539
Species: Hu, Mu, Rt
Applications: WB, ICC
AF5890
Species: Mu
Applications: WB, Simple Western, IHC
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NBP1-83242
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2147
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-91810
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
NBP1-89101
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-84717
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Contactin-4 Partial Recombinant Protein (H00152330-Q01) (0)

There are no publications for Contactin-4 Partial Recombinant Protein (H00152330-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Contactin-4 Partial Recombinant Protein (H00152330-Q01) (0)

There are no reviews for Contactin-4 Partial Recombinant Protein (H00152330-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Contactin-4 Partial Recombinant Protein (H00152330-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Contactin-4 Products

Bioinformatics Tool for Contactin-4 Partial Recombinant Protein (H00152330-Q01)

Discover related pathways, diseases and genes to Contactin-4 Partial Recombinant Protein (H00152330-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Contactin-4 Partial Recombinant Protein (H00152330-Q01)

Discover more about diseases related to Contactin-4 Partial Recombinant Protein (H00152330-Q01).
 

Pathways for Contactin-4 Partial Recombinant Protein (H00152330-Q01)

View related products by pathway.

PTMs for Contactin-4 Partial Recombinant Protein (H00152330-Q01)

Learn more about PTMs related to Contactin-4 Partial Recombinant Protein (H00152330-Q01).

Blogs on Contactin-4

There are no specific blogs for Contactin-4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Contactin-4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTN4
Entrez