Contactin-1 Antibody

Images

 
Immunohistochemistry-Paraffin: Contactin-1 Antibody [NBP1-84763] - Staining of human hippocampus shows moderate positivity in neuropil.

Product Details

Summary
Product Discontinued
View other related Contactin-1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-84763
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Contactin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GGGGRNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMSPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPS
Specificity
Specificity of human, mouse Contactin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using NBP1-84763.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28781169).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Contactin-1 Antibody

  • CNTN1
  • contactin 1
  • Contactin1
  • Contactin-1
  • F11
  • F3
  • F3cam
  • Glycoprotein gp135
  • GP135
  • Neural cell surface protein F3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65538
Species: Hu
NBP2-14893
Species: Hu
Applications: WB, IHC, IHC-P
AF2338
Species: Hu
Applications: WB, IP, ICC
H00201780-P01
Species: Hu
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
NBP1-91258
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Contactin-1 Antibody (NBP1-84763)(1)

We have publications tested in 1 confirmed species: Mouse.


Filter By Application
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Contactin-1 Antibody (NBP1-84763) (0)

There are no reviews for Contactin-1 Antibody (NBP1-84763). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Contactin-1 Antibody (NBP1-84763) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Contactin-1 Products

Bioinformatics Tool for Contactin-1 Antibody (NBP1-84763)

Discover related pathways, diseases and genes to Contactin-1 Antibody (NBP1-84763). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Contactin-1 Antibody (NBP1-84763)

Discover more about diseases related to Contactin-1 Antibody (NBP1-84763).
 

Pathways for Contactin-1 Antibody (NBP1-84763)

View related products by pathway.

PTMs for Contactin-1 Antibody (NBP1-84763)

Learn more about PTMs related to Contactin-1 Antibody (NBP1-84763).

Blogs on Contactin-1

There are no specific blogs for Contactin-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Contactin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTN1
Entrez