COMT Antibody

Images

 
Western Blot: COMT Antibody [NBP1-69290] - This Anti-COMT antibody was used in Western Blot of Fetal Stomach tissue lysate at a concentration of 1ug/ml.
Western Blot: COMT Antibody [NBP1-69290] - Lanes: 1. 100 ug Human lung microsome lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Secondary, Antibody Dilution: 1 : 10000 Gene name: COMT.

Product Details

Summary
Product Discontinued
View other related COMT Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69290
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

COMT Antibody Summary

Immunogen
Synthetic peptides corresponding to COMT(catechol-O-methyltransferase) The peptide sequence was selected from the middle region of COMT. Peptide sequence PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH.
Clonality
Polyclonal
Host
Rabbit
Gene
COMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against COMT and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for COMT Antibody

  • catechol O-methyltransferase
  • catechol-O-methyltransferase
  • COMT
  • EC 2.1.1.6

Background

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathwa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
H00001815-R02
Species: Hu
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF8216
Species: Hu, Mu, Rt
Applications: WB
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P

Publications for COMT Antibody (NBP1-69290) (0)

There are no publications for COMT Antibody (NBP1-69290).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COMT Antibody (NBP1-69290) (0)

There are no reviews for COMT Antibody (NBP1-69290). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COMT Antibody (NBP1-69290) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COMT Products

Bioinformatics Tool for COMT Antibody (NBP1-69290)

Discover related pathways, diseases and genes to COMT Antibody (NBP1-69290). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COMT Antibody (NBP1-69290)

Discover more about diseases related to COMT Antibody (NBP1-69290).
 

Pathways for COMT Antibody (NBP1-69290)

View related products by pathway.

PTMs for COMT Antibody (NBP1-69290)

Learn more about PTMs related to COMT Antibody (NBP1-69290).
 

Research Areas for COMT Antibody (NBP1-69290)

Find related products by research area.

Blogs on COMT

There are no specific blogs for COMT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COMT
Entrez
Uniprot