Complement Component C5a R1 Antibody


Western Blot: Complement Component C5a R1 Antibody [NBP1-68892] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Complement Component C5a R1 Antibody Summary

Synthetic peptides corresponding to C5AR1 (complement component 5a receptor 1) The peptide sequence was selected from the C terminal of C5AR1. Peptide sequence SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C5AR1 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Complement Component C5a R1 Antibody

  • C5a anaphylatoxin chemotactic receptor
  • C5A
  • C5aR
  • C5a-R
  • C5AR1
  • C5ARC5a anaphylatoxin receptor
  • C5R1C5a ligand
  • CD88 antigen
  • CD88
  • complement component 5 receptor 1 (C5a ligand)
  • complement component 5 receptor 1
  • complement component 5a receptor 1
  • Complement Component C5a R1
  • Complement Component C5aR1


C5AR1 is the receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu, Pm
Applications: WB, Simple Western
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready

Publications for Complement Component C5a R1 Antibody (NBP1-68892) (0)

There are no publications for Complement Component C5a R1 Antibody (NBP1-68892).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Component C5a R1 Antibody (NBP1-68892) (0)

There are no reviews for Complement Component C5a R1 Antibody (NBP1-68892). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Component C5a R1 Antibody (NBP1-68892) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Complement Component C5a R1 Products

Bioinformatics Tool for Complement Component C5a R1 Antibody (NBP1-68892)

Discover related pathways, diseases and genes to Complement Component C5a R1 Antibody (NBP1-68892). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Component C5a R1 Antibody (NBP1-68892)

Discover more about diseases related to Complement Component C5a R1 Antibody (NBP1-68892).

Pathways for Complement Component C5a R1 Antibody (NBP1-68892)

View related products by pathway.

PTMs for Complement Component C5a R1 Antibody (NBP1-68892)

Learn more about PTMs related to Complement Component C5a R1 Antibody (NBP1-68892).

Research Areas for Complement Component C5a R1 Antibody (NBP1-68892)

Find related products by research area.

Blogs on Complement Component C5a R1

There are no specific blogs for Complement Component C5a R1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Complement Component C5a R1 Antibody and receive a gift card or discount.


Gene Symbol C5AR1