Complement Component C3a R Antibody

Images

 
Western Blot: Complement Component C3a R Antibody [H00000719-D01P] - Analysis of C3AR1 expression in human liver.
Western Blot: Complement Component C3a R Antibody [H00000719-D01P] - Analysis of C3AR1 expression in transfected 293T cell line by C3AR1 polyclonal antibody.Lane 1: C3AR1 transfected lysate(53.90 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement Component C3a R Antibody Summary

Immunogen
C3AR1 (NP_004045.1, 1 a.a. - 482 a.a.) full-length human protein. MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C3AR1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Complement Component C3a R Antibody

  • AZ3B
  • AZ3BC3a anaphylatoxin chemotactic receptor
  • C3AR
  • C3a-R
  • C3AR1
  • C3ARcomplement component 3 receptor 1
  • C3R1
  • complement component 3a receptor 1
  • Complement Component C3a R
  • Complement Component C3aR
  • HNFAG09

Background

The complement factor C3 consists of an alpha and a beta chain. C3 is a central factor in the complement cascade. It is central to the alternative pathway that leads to the C3 convertase C3bBb. The classical mannose binding lectin activation pathway leads to the C3 convertase C4b2a. These convertases cleave C3 resulting in C3a and C3b. Further degradation leads to the formation of the alpha chain products C3d, C3g and C3c. C3 is an acute phase protein that is produced by a wide range of tissues, including renal epithelial cells and hepatocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11867
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2009
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00441931-R02
Species: Hu
H00000719-D01P
Species: Hu
Applications: WB

Publications for Complement Component C3a R Antibody (H00000719-D01P) (0)

There are no publications for Complement Component C3a R Antibody (H00000719-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Component C3a R Antibody (H00000719-D01P) (0)

There are no reviews for Complement Component C3a R Antibody (H00000719-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Component C3a R Antibody (H00000719-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Component C3a R Products

Bioinformatics Tool for Complement Component C3a R Antibody (H00000719-D01P)

Discover related pathways, diseases and genes to Complement Component C3a R Antibody (H00000719-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Component C3a R Antibody (H00000719-D01P)

Discover more about diseases related to Complement Component C3a R Antibody (H00000719-D01P).
 

Pathways for Complement Component C3a R Antibody (H00000719-D01P)

View related products by pathway.

PTMs for Complement Component C3a R Antibody (H00000719-D01P)

Learn more about PTMs related to Complement Component C3a R Antibody (H00000719-D01P).

Blogs on Complement Component C3a R

There are no specific blogs for Complement Component C3a R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Component C3a R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C3AR1
Entrez
Uniprot