Complement Component C1qC Antibody - Azide and BSA Free

Western Blot: Complement Component C1qC Antibody [H00000714-D01P] - Analysis of C1QC expression in human spleen.

Western Blot: Complement Component C1qC Antibody [H00000714-D01P] - Analysis of C1QC expression in transfected 293T cell line by C1QC polyclonal antibody.Lane 1: C1QC transfected lysate(25.80 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Complement Component C1qC Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: C1QC (NP_758957.2, 1 a.a. - 245 a.a.) full-length human protein. MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
• Specificity: Reacts with complement component 1, q subcomponent, C chain.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C1QC
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Complement Component C1qC Antibody - Azide and BSA Free

• C1qC
• C1Q-C
• C1QGcomplement component 1, q subcomponent, gamma polypeptide
• complement C1q subcomponent subunit C
• complement component 1, q subcomponent, C chain
• Complement Component C1qC
• FLJ27103

Background

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the C-chain polypeptide of human complement subcomponent C1q. Alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C1QC
• Entrez:
  • 714(Human)
• Uniprot:
  • NP_758957.2(Human)