Complement Component C1qC Antibody

Images

 
Western Blot: Complement Component C1qC Antibody [H00000714-B01P] - Analysis of C1QC expression in transfected 293T cell line by C1QC polyclonal antibody. Lane 1: C1QG transfected lysate(26.95 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Complement Component C1qC Antibody Summary

Immunogen
C1QC (NP_758957.2, 1 a.a. - 245 a.a.) full-length human protein. MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
C1QC
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Complement Component C1qC Antibody

  • C1qC
  • C1Q-C
  • C1QGcomplement component 1, q subcomponent, gamma polypeptide
  • complement C1q subcomponent subunit C
  • complement component 1, q subcomponent, C chain
  • Complement Component C1qC
  • FLJ27103

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-539
Species: Mu
Applications: Func, IA, ICC/IF, IHC, IHC-Fr
H00000713-D01P
Species: Hu, Mu
Applications: WB
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00000712-P01
Species: Hu
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
AF1936
Species: Hu
Applications: WB, IP
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
MAB10541
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF3388
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Complement Component C1qC Antibody (H00000714-B01P) (0)

There are no publications for Complement Component C1qC Antibody (H00000714-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Component C1qC Antibody (H00000714-B01P) (0)

There are no reviews for Complement Component C1qC Antibody (H00000714-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Component C1qC Antibody (H00000714-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Complement Component C1qC Products

Bioinformatics Tool for Complement Component C1qC Antibody (H00000714-B01P)

Discover related pathways, diseases and genes to Complement Component C1qC Antibody (H00000714-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Component C1qC Antibody (H00000714-B01P)

Discover more about diseases related to Complement Component C1qC Antibody (H00000714-B01P).
 

Pathways for Complement Component C1qC Antibody (H00000714-B01P)

View related products by pathway.

PTMs for Complement Component C1qC Antibody (H00000714-B01P)

Learn more about PTMs related to Complement Component C1qC Antibody (H00000714-B01P).

Blogs on Complement Component C1qC

There are no specific blogs for Complement Component C1qC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement Component C1qC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QC
Entrez
Uniprot