Complement Component C1qA Antibody


Western Blot: C1QA Antibody [NBP1-68893] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Product Discontinued
View other related Complement Component C1qA Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Complement Component C1qA Antibody Summary

Synthetic peptides corresponding to C1QA (complement component 1, q subcomponent, A chain) The peptide sequence was selected from the N terminal of C1QA. Peptide sequence PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG.
This product is specific to Subunit or Isoform: A.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C1QA and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Complement Component C1qA Antibody

  • C1QA complement component 1, q subcomponent, A chain
  • C1QA
  • Complement Component C1qA


This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the A-chain polypeptide of human complement subcomponent C1q.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB

Publications for Complement Component C1qA Antibody (NBP1-68893) (0)

There are no publications for Complement Component C1qA Antibody (NBP1-68893).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement Component C1qA Antibody (NBP1-68893) (0)

There are no reviews for Complement Component C1qA Antibody (NBP1-68893). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement Component C1qA Antibody (NBP1-68893) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Complement Component C1qA Products

Complement Component C1qA NBP1-68893

Bioinformatics Tool for Complement Component C1qA Antibody (NBP1-68893)

Discover related pathways, diseases and genes to Complement Component C1qA Antibody (NBP1-68893). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement Component C1qA Antibody (NBP1-68893)

Discover more about diseases related to Complement Component C1qA Antibody (NBP1-68893).

Pathways for Complement Component C1qA Antibody (NBP1-68893)

View related products by pathway.

PTMs for Complement Component C1qA Antibody (NBP1-68893)

Learn more about PTMs related to Complement Component C1qA Antibody (NBP1-68893).

Research Areas for Complement Component C1qA Antibody (NBP1-68893)

Find related products by research area.

Blogs on Complement Component C1qA

There are no specific blogs for Complement Component C1qA, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Complement Component C1qA Antibody and receive a gift card or discount.


Gene Symbol C1QA