Recombinant Mouse Complement C3 Protein

Images

 
SDS-Page: Recombinant Mouse Complement C3 Protein [P3343] - 12.5% SDS-PAGE Stained with Coomassie Blue

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Mouse Complement C3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 671 - 747 of Mouse C3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLA

Protein/Peptide Type
Recombinant Protein
Gene
C3

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Mouse Complement C3 Protein

  • AHUS5
  • ARMD9
  • ASP
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1
  • complement C3
  • complement component 3
  • complement component C3
  • CPAMD1acylation-stimulating protein cleavage product

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
H00000712-P01
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
AF8216
Species: Hu, Mu, Rt
Applications: WB
NB120-11867
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-P
P3343
Species: Mu
Applications: WB, ELISA, PA

Publications for Complement C3 Recombinant Protein (P3343) (0)

There are no publications for Complement C3 Recombinant Protein (P3343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement C3 Recombinant Protein (P3343) (0)

There are no reviews for Complement C3 Recombinant Protein (P3343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement C3 Recombinant Protein (P3343). (Showing 1 - 1 of 1 FAQ).

  1. I am trying to establish a method to measure mice C3 levels by nephelometry. I would be most grateful if you could provide me with some help, regarding the choice of the Ab. I totally understand that since such a method has never been tried, I do not expect any guaranties. 
    • We have never performed nephelometry in our lab, and do not have a protocol or advice to provide about this application. However, it seems to me that you should choose an antibody that is capable of recognizing its target in its folded conformation. Therefore, I would suggest trying an antibody that has been validated for ICC or IHC.

Additional Complement C3 Products

Bioinformatics Tool for Complement C3 Recombinant Protein (P3343)

Discover related pathways, diseases and genes to Complement C3 Recombinant Protein (P3343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement C3 Recombinant Protein (P3343)

Discover more about diseases related to Complement C3 Recombinant Protein (P3343).
 

Pathways for Complement C3 Recombinant Protein (P3343)

View related products by pathway.

PTMs for Complement C3 Recombinant Protein (P3343)

Learn more about PTMs related to Complement C3 Recombinant Protein (P3343).

Blogs on Complement C3.

Complement C3 - the most important protein in the complement system
The complement system is made up of a collection of proteins found in the bloodstream and is comprised of nine major complement proteins; complement C3 is one of them. The complement system is a crucial component of the cellular immune system becau...  Read full blog post.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Mouse Complement C3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C3