Recombinant Human Collagen XXIII alpha 1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Collagen XXIII alpha 1 Peptides and Proteins

Order Details


    • Catalog Number
      H00091522-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Collagen XXIII alpha 1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 338 - 410 of Human COL23A1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KGELGLPGAPGIDGEKGPKGQKGDPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVE

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
COL23A1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
No additives

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Collagen XXIII alpha 1 Protein

  • COL23A1
  • collagen alpha-1(XXIII) chain
  • Collagen XXIII alpha 1
  • collagen, type XXIII, alpha 1
  • DKFZp434K0621
  • procollagen, type XXIII, alpha 1

Background

COL23A1 - collagen, type XXIII, alpha 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33759
Species: Mu
Applications: WB, IHC, IHC-P
7707-NP
Species: Hu
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4036
Species: Hu
Applications: WB, Simple Western
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF3044
Species: Hu
Applications: WB, ICC
AF2569
Species: Hu
Applications: WB, ICC
NBP2-45897
Species: Hu
Applications: WB, IHC
232-FA/CF
Species: Hu
NB600-594
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010424-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00091522-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01) (0)

There are no publications for Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01) (0)

There are no reviews for Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Collagen XXIII alpha 1 Products

Bioinformatics Tool for Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01)

Discover related pathways, diseases and genes to Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01)

Discover more about diseases related to Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01).
 

Pathways for Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01)

View related products by pathway.

PTMs for Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01)

Learn more about PTMs related to Collagen XXIII alpha 1 Partial Recombinant Protein (H00091522-Q01).

Blogs on Collagen XXIII alpha 1

There are no specific blogs for Collagen XXIII alpha 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Collagen XXIII alpha 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COL23A1
Entrez