Collagen XXI Antibody

Images

 
Immunohistochemistry: Collagen XXI Antibody [NBP1-90355] - Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related Collagen XXI Primary Antibodies

Order Details


    • Catalog Number
      NBP1-90355
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Collagen XXI Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILLFTTTSVINGSQVVTFANPQVKTLFDEGWHQIRLLVTEQDVTLYIDDQQIENKPLHPVLGILINGQTQIGKY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL21A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Collagen XXI Antibody

  • alpha 1 chain-like collagen
  • alpha 1 type XXI collagen
  • COL1AL
  • COLA1L
  • Collagen 21
  • collagen alpha-1(XXI) chain
  • collagen, type XXI, alpha 1
  • Collagen-21
  • dJ682J15.1
  • dJ708F5.1
  • DKFZp564B052
  • FLJ39125
  • FLJ44623
  • MGC26619

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6526
Species: Hu
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7178
Species: Hu
Applications: WB, Simple Western
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
AF5286
Species: Hu
Applications: WB
AF3075
Species: Hu
Applications: WB, ICC
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
AF7715
Species: Hu
Applications: WB, IHC
MAB1599
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-42397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90355
Species: Hu
Applications: IHC, IHC-P

Publications for Collagen XXI Antibody (NBP1-90355) (0)

There are no publications for Collagen XXI Antibody (NBP1-90355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XXI Antibody (NBP1-90355) (0)

There are no reviews for Collagen XXI Antibody (NBP1-90355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Collagen XXI Antibody (NBP1-90355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Collagen XXI Products

Bioinformatics Tool for Collagen XXI Antibody (NBP1-90355)

Discover related pathways, diseases and genes to Collagen XXI Antibody (NBP1-90355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen XXI Antibody (NBP1-90355)

Discover more about diseases related to Collagen XXI Antibody (NBP1-90355).
 

Pathways for Collagen XXI Antibody (NBP1-90355)

View related products by pathway.

PTMs for Collagen XXI Antibody (NBP1-90355)

Learn more about PTMs related to Collagen XXI Antibody (NBP1-90355).
 

Research Areas for Collagen XXI Antibody (NBP1-90355)

Find related products by research area.

Blogs on Collagen XXI

There are no specific blogs for Collagen XXI, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Collagen XXI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL21A1