Collagen XXI Antibody


Immunohistochemistry: Collagen XXI Antibody [NBP1-90355] - Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Product Discontinued
View other related Collagen XXI Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Collagen XXI Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:ILLFTTTSVINGSQVVTFANPQVKTLFDEGWHQIRLLVTEQDVTLYIDDQQIENKPLHPVLGILINGQTQIGKY
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Collagen XXI Antibody

  • alpha 1 chain-like collagen
  • alpha 1 type XXI collagen
  • COL1AL
  • COLA1L
  • Collagen 21
  • collagen alpha-1(XXI) chain
  • collagen, type XXI, alpha 1
  • Collagen-21
  • dJ682J15.1
  • dJ708F5.1
  • DKFZp564B052
  • FLJ39125
  • FLJ44623
  • MGC26619


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: IHC-P, ICC
Species: Hu
Applications: Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P

Publications for Collagen XXI Antibody (NBP1-90355) (0)

There are no publications for Collagen XXI Antibody (NBP1-90355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen XXI Antibody (NBP1-90355) (0)

There are no reviews for Collagen XXI Antibody (NBP1-90355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Collagen XXI Antibody (NBP1-90355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Collagen XXI Products

Bioinformatics Tool for Collagen XXI Antibody (NBP1-90355)

Discover related pathways, diseases and genes to Collagen XXI Antibody (NBP1-90355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Collagen XXI Antibody (NBP1-90355)

Discover more about diseases related to Collagen XXI Antibody (NBP1-90355).

Pathways for Collagen XXI Antibody (NBP1-90355)

View related products by pathway.

PTMs for Collagen XXI Antibody (NBP1-90355)

Learn more about PTMs related to Collagen XXI Antibody (NBP1-90355).

Research Areas for Collagen XXI Antibody (NBP1-90355)

Find related products by research area.

Blogs on Collagen XXI

There are no specific blogs for Collagen XXI, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Collagen XXI Antibody and receive a gift card or discount.


Gene Symbol COL21A1