COL27A1 Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related COL27A1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-30880
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

COL27A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PVLLPFHRDPALDPGGSFLFGKMNPHAVQFEGALCQFSIYPVTQVAHNYCTHLRKQCGQADTYQSPLGPLFSQDSGRP
Specificity
Specificity of human COL27A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL27A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COL27A1 Antibody

  • Collagen Alpha-1(XXVII) Chain
  • Collagen, Type XXVII, Alpha 1
  • KIAA1870

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF5797
Species: Mu, Rt
Applications: WB, IP
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-58159
Species: Hu, Mu
Applications: ICC/IF, IHC
AF3234
Species: Mu
Applications: WB
NBP1-26551
Species: Hu, Bv, Eq
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-Fr
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF339
Species: Hu
Applications: WB, IHC, Block
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-59322
Species: Hu
Applications: WB, IHC, IHC-P
NB600-450
Species: Hu, Mu, Rt, Po, Bv, Eq, Fe, Ma, Rb
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for COL27A1 Antibody (NBP2-30880) (0)

There are no publications for COL27A1 Antibody (NBP2-30880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COL27A1 Antibody (NBP2-30880) (0)

There are no reviews for COL27A1 Antibody (NBP2-30880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for COL27A1 Antibody (NBP2-30880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional COL27A1 Products

Bioinformatics Tool for COL27A1 Antibody (NBP2-30880)

Discover related pathways, diseases and genes to COL27A1 Antibody (NBP2-30880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COL27A1 Antibody (NBP2-30880)

Discover more about diseases related to COL27A1 Antibody (NBP2-30880).
 

Pathways for COL27A1 Antibody (NBP2-30880)

View related products by pathway.

Blogs on COL27A1

There are no specific blogs for COL27A1, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COL27A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL27A1
Uniprot