Recombinant Human Cofilin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Cofilin Peptides and Proteins

Order Details


    • Catalog Number
      H00001072-P02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Cofilin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-166 of Human CFL1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFRLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEELGGSAVISLEGKPL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CFL1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cofilin Protein

  • 18 kDa phosphoprotein
  • CFL
  • cofilin 1 (non-muscle)
  • Cofilin, non-muscle isoform
  • cofilin-1
  • p18

Background

Cofilin is a small phosphoinositide sensitive, actin binding protein capable of depolymerizing actin filaments in vitro. Under certain conditions, it fragments the filaments and accelerates actin subunit dissociation from their 'pointed' (minus) ends. Cofilin binds stoichiometrically to monomeric G-actin and to actin protomers in filaments in an apparent pH-dependent, Ca2+ independent manner. Cofilin intercalates between longitudinally associated actin monomers within the filament and distorts its helical twist. Cofilin is ubiquitous in tissues of eukaryotes and is especially abundant in neuronal tissues. It is essential for viability and is important for many cellular processes involving actin remodeling such as motility at the leading edge of cells, polarized cell growth, endocytosis, phagocytosis, cellular activation, cytokinesis, and pathogen intracellular motility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC

Publications for Cofilin Recombinant Protein (H00001072-P02) (0)

There are no publications for Cofilin Recombinant Protein (H00001072-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cofilin Recombinant Protein (H00001072-P02) (0)

There are no reviews for Cofilin Recombinant Protein (H00001072-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cofilin Recombinant Protein (H00001072-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cofilin Products

Bioinformatics Tool for Cofilin Recombinant Protein (H00001072-P02)

Discover related pathways, diseases and genes to Cofilin Recombinant Protein (H00001072-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cofilin Recombinant Protein (H00001072-P02)

Discover more about diseases related to Cofilin Recombinant Protein (H00001072-P02).
 

Pathways for Cofilin Recombinant Protein (H00001072-P02)

View related products by pathway.

PTMs for Cofilin Recombinant Protein (H00001072-P02)

Learn more about PTMs related to Cofilin Recombinant Protein (H00001072-P02).
 

Research Areas for Cofilin Recombinant Protein (H00001072-P02)

Find related products by research area.

Blogs on Cofilin.

ACTB - an abundant cytoskeletal component with applications for gene expression analysis
Actin is the widely studied and ubiquitous cytoskeletal protein capable of forming dynamic microfilament structures. These filaments are essential for diverse cellular functions including cell shape, migration, cytokinesis, and intracellular traffi...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cofilin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CFL1