Cofilin Antibody (1A1) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Cofilin Primary Antibodies

Order Details


    • Catalog Number
      H00001072-M04PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cofilin Antibody (1A1) [PE] Summary

Immunogen
CFL1 (AAH11005, 1 a.a. - 166 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Specificity
cofilin 1 (non-muscle)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CFL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cofilin Antibody (1A1) [PE]

  • 18 kDa phosphoprotein
  • CFL
  • cofilin 1 (non-muscle)
  • Cofilin, non-muscle isoform
  • cofilin-1
  • p18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC

Publications for Cofilin Antibody (H00001072-M04PE) (0)

There are no publications for Cofilin Antibody (H00001072-M04PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cofilin Antibody (H00001072-M04PE) (0)

There are no reviews for Cofilin Antibody (H00001072-M04PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cofilin Antibody (H00001072-M04PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cofilin Products

Bioinformatics Tool for Cofilin Antibody (H00001072-M04PE)

Discover related pathways, diseases and genes to Cofilin Antibody (H00001072-M04PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cofilin Antibody (H00001072-M04PE)

Discover more about diseases related to Cofilin Antibody (H00001072-M04PE).
 

Pathways for Cofilin Antibody (H00001072-M04PE)

View related products by pathway.

PTMs for Cofilin Antibody (H00001072-M04PE)

Learn more about PTMs related to Cofilin Antibody (H00001072-M04PE).
 

Research Areas for Cofilin Antibody (H00001072-M04PE)

Find related products by research area.

Blogs on Cofilin.

ACTB - an abundant cytoskeletal component with applications for gene expression analysis
Actin is the widely studied and ubiquitous cytoskeletal protein capable of forming dynamic microfilament structures. These filaments are essential for diverse cellular functions including cell shape, migration, cytokinesis, and intracellular traffi...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cofilin Antibody (1A1) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol CFL1