Cofilin 2 Antibody (6G9) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Cofilin 2 Primary Antibodies

Order Details


    • Catalog Number
      H00001073-M03PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cofilin 2 Antibody (6G9) [PerCP] Summary

Immunogen
CFL2 (NP_068733, 57 a.a. - 166 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Specificity
CFL2 - cofilin 2 (muscle)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CFL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cofilin 2 Antibody (6G9) [PerCP]

  • cofilin 2 (muscle)
  • Cofilin, muscle isoform
  • cofilin-2
  • NEM7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001072-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-71870
Species: Hu
Applications: WB, IP, PLA
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32748
Species: Hu, Po
Applications: WB, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85783
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001073-M03PCP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Cofilin 2 Antibody (H00001073-M03PCP) (0)

There are no publications for Cofilin 2 Antibody (H00001073-M03PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cofilin 2 Antibody (H00001073-M03PCP) (0)

There are no reviews for Cofilin 2 Antibody (H00001073-M03PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cofilin 2 Antibody (H00001073-M03PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cofilin 2 Products

Bioinformatics Tool for Cofilin 2 Antibody (H00001073-M03PCP)

Discover related pathways, diseases and genes to Cofilin 2 Antibody (H00001073-M03PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cofilin 2 Antibody (H00001073-M03PCP)

Discover more about diseases related to Cofilin 2 Antibody (H00001073-M03PCP).
 

Pathways for Cofilin 2 Antibody (H00001073-M03PCP)

View related products by pathway.

PTMs for Cofilin 2 Antibody (H00001073-M03PCP)

Learn more about PTMs related to Cofilin 2 Antibody (H00001073-M03PCP).

Blogs on Cofilin 2

There are no specific blogs for Cofilin 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cofilin 2 Antibody (6G9) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol CFL2