Recombinant Human Coagulation Factor XIV/Protein C Protein

Order Details


    • Catalog Number
      H00005624-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Coagulation Factor XIV/Protein C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32-131 of Human PROC partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PROC

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Coagulation Factor XIV/Protein C Protein

  • Anticoagulant protein C
  • APC
  • Autoprothrombin IIA
  • Blood coagulation factor XIV
  • Coagulation Factor XIV
  • EC 3.4.21
  • EC 3.4.21.69
  • PC
  • PROC
  • PROC1
  • protein C (inactivator of coagulation factors Va and VIIIa)
  • Protein C
  • vitamin K-dependent protein C

Background

PROC - protein C (inactivator of coagulation factors Va and VIIIa)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07799
Species: Hu
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct

Publications for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01) (0)

There are no publications for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01) (0)

There are no reviews for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Coagulation Factor XIV/Protein C Products

Bioinformatics Tool for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01)

Discover related pathways, diseases and genes to Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01)

Discover more about diseases related to Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01).
 

Pathways for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01)

View related products by pathway.

PTMs for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01)

Learn more about PTMs related to Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01).
 

Research Areas for Coagulation Factor XIV/Protein C Partial Recombinant Protein (H00005624-Q01)

Find related products by research area.

Blogs on Coagulation Factor XIV/Protein C

There are no specific blogs for Coagulation Factor XIV/Protein C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Coagulation Factor XIV/Protein C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PROC
Entrez