Recombinant Human Coagulation Factor VII Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Coagulation Factor VII Peptides and Proteins

Order Details


    • Catalog Number
      H00002155-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Coagulation Factor VII Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human F7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGR

Protein/Peptide Type
Partial Recombinant Protein
Gene
F7

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Coagulation Factor VII Protein

  • coagulation factor VII (serum prothrombin conversion accelerator)
  • Coagulation Factor VII
  • EC 3.4.21
  • EC 3.4.21.21
  • Eptacog alfa
  • F7
  • FVII coagulation protein
  • proconvertin
  • Serum prothrombin conversion accelerator
  • SPCA

Background

F7 - coagulation factor VII (serum prothrombin conversion accelerator)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00027032-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01) (0)

There are no publications for Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01) (0)

There are no reviews for Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Coagulation Factor VII Products

Bioinformatics Tool for Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01)

Discover related pathways, diseases and genes to Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01)

Discover more about diseases related to Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01).
 

Pathways for Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01)

View related products by pathway.

PTMs for Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01)

Learn more about PTMs related to Coagulation Factor VII Partial Recombinant Protein (H00002155-Q01).

Blogs on Coagulation Factor VII

There are no specific blogs for Coagulation Factor VII, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Coagulation Factor VII Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol F7
Entrez