Coagulation Factor III/Tissue Factor Antibody (4G4)

Images

 
Western Blot: Coagulation Factor III/Tissue Factor Antibody (4G4) [H00002152-M01A] - F3 monoclonal antibody (M01A), clone 4G4. Analysis of F3 expression in Jurkat.
Western Blot: Coagulation Factor III/Tissue Factor Antibody (4G4) [H00002152-M01A] - F3 monoclonal antibody (M01A), clone 4G4 Analysis of F3 expression in A-431.
Western Blot: Coagulation Factor III/Tissue Factor Antibody (4G4) [H00002152-M01A] - Analysis of F3 expression in transfected 293T cell line by F3 monoclonal antibody (M01A), clone 4G4.Lane 1: F3 transfected lysate(33.1 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Coagulation Factor III/Tissue Factor Antibody (4G4) Summary

Immunogen
F3 (AAH11029, 45 a.a. - 154 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
Specificity
F3 - coagulation factor III (thromboplastin, tissue factor)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
F3
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.
Publications
Read Publication using H00002152-M01A.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Coagulation Factor III/Tissue Factor Antibody (4G4)

  • CD142 antigen
  • CD142
  • coagulation factor III (thromboplastin, tissue factor)
  • Coagulation Factor III
  • F3
  • FLJ17960
  • TF
  • TFA
  • Thromboplastin
  • Tissue Factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-07799
Species: Hu
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A)(1)

Reviews for Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A) (0)

There are no reviews for Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A). (Showing 1 - 1 of 1 FAQ).

  1. Have you tested any of your anti-tissue factor antibodies against pig? I need one for western blot.
    • Unfortunately, none of our Tissue Factor antibodies have yet been tested with pig samples, so we cannot guarantee that any of them will work in pig. Here is a link to Tissue Factor antibodies that have been validated for use in Western blot. If you are interested in testing any of these antibodies against pig samples, you could become eligible for our Innovator's Reward program.

Secondary Antibodies

 

Isotype Controls

Additional Coagulation Factor III/Tissue Factor Products

Bioinformatics Tool for Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A)

Discover related pathways, diseases and genes to Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A)

Discover more about diseases related to Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A).
 

Pathways for Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A)

View related products by pathway.

PTMs for Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A)

Learn more about PTMs related to Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A).
 

Research Areas for Coagulation Factor III/Tissue Factor Antibody (H00002152-M01A)

Find related products by research area.

Blogs on Coagulation Factor III/Tissue Factor

There are no specific blogs for Coagulation Factor III/Tissue Factor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Coagulation Factor III/Tissue Factor Antibody (4G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol F3
Entrez