CNTF Antibody

Images

 
Western Blot: CNTF Antibody [H00001270-B01P] - Analysis of CNTF expression in transfected 293T cell line by CNTF polyclonal antibody. Lane 1: CNTF transfected lysate(22 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CNTF Antibody Summary

Immunogen
CNTF (NP_000605.1, 1 a.a. - 200 a.a.) full-length human protein. MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CNTF
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CNTF Antibody

  • ciliary neurotrophic factor
  • CNTF
  • HCNTF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF-303-NA
Species: Hu
Applications: WB, Neut
NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF-249-NA
Species: Hu
Applications: WB, Neut
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
H00001270-B01P
Species: Hu
Applications: WB

Publications for CNTF Antibody (H00001270-B01P) (0)

There are no publications for CNTF Antibody (H00001270-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNTF Antibody (H00001270-B01P) (0)

There are no reviews for CNTF Antibody (H00001270-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNTF Antibody (H00001270-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNTF Products

Bioinformatics Tool for CNTF Antibody (H00001270-B01P)

Discover related pathways, diseases and genes to CNTF Antibody (H00001270-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNTF Antibody (H00001270-B01P)

Discover more about diseases related to CNTF Antibody (H00001270-B01P).
 

Pathways for CNTF Antibody (H00001270-B01P)

View related products by pathway.

PTMs for CNTF Antibody (H00001270-B01P)

Learn more about PTMs related to CNTF Antibody (H00001270-B01P).
 

Research Areas for CNTF Antibody (H00001270-B01P)

Find related products by research area.

Blogs on CNTF

There are no specific blogs for CNTF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNTF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNTF
Entrez
Uniprot