CNKR2 Antibody

Images

 
Western Blot: CNKR2 Antibody [NBP1-88065] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: CNKR2 Antibody [NBP1-88065] - Staining of human cell line A-431 shows positivity in plasma membrane and golgi apparatus.
Immunohistochemistry-Paraffin: CNKR2 Antibody [NBP1-88065] - Staining of human testis shows nuclear positivity in cells of seminiferus ducts.
Western Blot: CNKR2 Antibody [NBP1-88065] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human fallopian tube

Product Details

Summary
Product Discontinued
View other related CNKR2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88065
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CNKR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLQDLYRALEQASLSPLGEHRISTKMEYKLSFIKRCNDPVMNEKLHRLRILKSTLKAREGEVAIIDKVLDNPDLTSKEFQQWKQMYLDLFLDICQNTTSNDPLSISSEVDVITSSLAHTHSYIET
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNKSR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
118 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNKR2 Antibody

  • CNK homolog protein 2
  • CNK2MAGUIN
  • connector enhancer of kinase suppressor of Ras 2
  • Connector enhancer of KSR 2
  • KIAA0902KSR2connector enhancer of KSR2
  • membrane-associated guanylate kinase-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84420
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82863
Species: Hu
Applications: IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88065
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CNKR2 Antibody (NBP1-88065) (0)

There are no publications for CNKR2 Antibody (NBP1-88065).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNKR2 Antibody (NBP1-88065) (0)

There are no reviews for CNKR2 Antibody (NBP1-88065). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNKR2 Antibody (NBP1-88065) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Bioinformatics Tool for CNKR2 Antibody (NBP1-88065)

Discover related pathways, diseases and genes to CNKR2 Antibody (NBP1-88065). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNKR2 Antibody (NBP1-88065)

Discover more about diseases related to CNKR2 Antibody (NBP1-88065).
 

Pathways for CNKR2 Antibody (NBP1-88065)

View related products by pathway.

PTMs for CNKR2 Antibody (NBP1-88065)

Learn more about PTMs related to CNKR2 Antibody (NBP1-88065).

Blogs on CNKR2

There are no specific blogs for CNKR2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNKR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNKSR2
Entrez
Uniprot