CNGB1 Antibody

Images

 
Immunohistochemistry-Paraffin: CNGB1 Antibody [NBP1-84423] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNGB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRSNNKPKEEKSVLILPPRAGTPKLFNAALAMTGKMGGKGAKGGKLAHLRARLKELAALEAAAKQQELVEQAKSSQDVKGEEGSAAPDQHTHPKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNGB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNGB1 Protein (NBP1-84423PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNGB1 Antibody

  • CNCG3L
  • CNG channel beta-1
  • CNG-4
  • CNGB1B
  • cyclic nucleotide gated channel beta 1
  • cyclic nucleotide-gated cation channel 4
  • cyclic nucleotide-gated cation channel modulatory subunit
  • cyclic nucleotide-gated channel beta-1
  • GAR1
  • GARP
  • RCNC2
  • RCNCb
  • RCNCbeta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13656
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24664
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
H00001262-P01
Species: Hu
NBP1-85527
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-57268
Species: Hu
Applications: WB, ICC/IF
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-46273
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-30418
Species: Hu
Applications: IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for CNGB1 Antibody (NBP1-84423) (0)

There are no publications for CNGB1 Antibody (NBP1-84423).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNGB1 Antibody (NBP1-84423) (0)

There are no reviews for CNGB1 Antibody (NBP1-84423). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNGB1 Antibody (NBP1-84423) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNGB1 Products

Bioinformatics Tool for CNGB1 Antibody (NBP1-84423)

Discover related pathways, diseases and genes to CNGB1 Antibody (NBP1-84423). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNGB1 Antibody (NBP1-84423)

Discover more about diseases related to CNGB1 Antibody (NBP1-84423).
 

Pathways for CNGB1 Antibody (NBP1-84423)

View related products by pathway.

PTMs for CNGB1 Antibody (NBP1-84423)

Learn more about PTMs related to CNGB1 Antibody (NBP1-84423).

Blogs on CNGB1

There are no specific blogs for CNGB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNGB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNGB1