Recombinant Human CNBP Protein

Product Discontinued

Recombinant Human CNBP Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-100 of Human ZNF9 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHL

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: CNBP

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CNBP Protein

• CCHC-type zinc finger, nucleic acid binding protein
• cellular nucleic acid binding protein
• cellular nucleic acid-binding protein
• DM2
• erythroid differentiation-related
• FLJ11631
• PROMM
• RNF163CNBP1ZNF9ZCCHC22
• sterol regulatory element-binding protein
• zinc finger protein 273
• zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
• Zinc finger protein 9

Background

This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNBP