CMT Antibody


Western Blot: CMT Antibody [NBP1-69579] - This Anti-ICMT antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CMT Antibody Summary

Synthetic peptides corresponding to ICMT(isoprenylcysteine carboxyl methyltransferase) The peptide sequence was selected from the middle region of ICMT. Peptide sequence GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ICMT and was validated on Western blot.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CMT Antibody

  • EC
  • HSTE14
  • isoprenylcysteine carboxyl methyltransferase
  • Isoprenylcysteine carboxylmethyltransferase
  • MGC39955
  • MST098
  • pcCMT
  • Prenylated protein carboxyl methyltransferase
  • Prenylcysteine carboxyl methyltransferase
  • protein-S isoprenylcysteine O-methyltransferase
  • protein-S-isoprenylcysteine O-methyltransferase


ICMT is the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu
Applications: WB

Publications for CMT Antibody (NBP1-69579) (0)

There are no publications for CMT Antibody (NBP1-69579).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMT Antibody (NBP1-69579) (0)

There are no reviews for CMT Antibody (NBP1-69579). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CMT Antibody (NBP1-69579) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CMT Products

Bioinformatics Tool for CMT Antibody (NBP1-69579)

Discover related pathways, diseases and genes to CMT Antibody (NBP1-69579). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMT Antibody (NBP1-69579)

Discover more about diseases related to CMT Antibody (NBP1-69579).

Pathways for CMT Antibody (NBP1-69579)

View related products by pathway.

PTMs for CMT Antibody (NBP1-69579)

Learn more about PTMs related to CMT Antibody (NBP1-69579).

Blogs on CMT

There are no specific blogs for CMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CMT Antibody and receive a gift card or discount.


Gene Symbol ICMT