CLTB Antibody (4B12-1E3) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related CLTB Primary Antibodies

Order Details


    • Catalog Number
      H00001212-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CLTB Antibody (4B12-1E3) [PerCP] Summary

Immunogen
CLTB (AAH06457, 1 a.a. - 211 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Localization
Cytoplasmic
Specificity
CLTB - clathrin, light polypeptide (Lcb)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLTB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLTB Antibody (4B12-1E3) [PerCP]

  • clathrin light chain B
  • clathrin, light chain (Lcb)
  • clathrin, light chain B
  • clathrin, light polypeptide (Lcb)
  • Lcb

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59643
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20308
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38638
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
AF4937
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB300-613
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IM, IP
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00001212-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for CLTB Antibody (H00001212-M01PCP) (0)

There are no publications for CLTB Antibody (H00001212-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLTB Antibody (H00001212-M01PCP) (0)

There are no reviews for CLTB Antibody (H00001212-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLTB Antibody (H00001212-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLTB Products

Bioinformatics Tool for CLTB Antibody (H00001212-M01PCP)

Discover related pathways, diseases and genes to CLTB Antibody (H00001212-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLTB Antibody (H00001212-M01PCP)

Discover more about diseases related to CLTB Antibody (H00001212-M01PCP).
 

Pathways for CLTB Antibody (H00001212-M01PCP)

View related products by pathway.

PTMs for CLTB Antibody (H00001212-M01PCP)

Learn more about PTMs related to CLTB Antibody (H00001212-M01PCP).
 

Research Areas for CLTB Antibody (H00001212-M01PCP)

Find related products by research area.

Blogs on CLTB

There are no specific blogs for CLTB, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLTB Antibody (4B12-1E3) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol CLTB