CLIC3 Antibody (3F8) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related CLIC3 Primary Antibodies

Order Details


    • Catalog Number
      H00009022-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CLIC3 Antibody (3F8) [PE] Summary

Immunogen
CLIC3 (NP_004660, 137 a.a. - 236 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Specificity
CLIC3 - chloride intracellular channel 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLIC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLIC3 Antibody (3F8) [PE]

  • chloride intracellular channel 3
  • chloride intracellular channel protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00053405-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-48694
Species: Hu
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32516
Species: Hu
Applications: WB, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31793
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5286
Species: Hu
Applications: WB
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-91697
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009022-M02PE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for CLIC3 Antibody (H00009022-M02PE) (0)

There are no publications for CLIC3 Antibody (H00009022-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIC3 Antibody (H00009022-M02PE) (0)

There are no reviews for CLIC3 Antibody (H00009022-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLIC3 Antibody (H00009022-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLIC3 Products

Bioinformatics Tool for CLIC3 Antibody (H00009022-M02PE)

Discover related pathways, diseases and genes to CLIC3 Antibody (H00009022-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIC3 Antibody (H00009022-M02PE)

Discover more about diseases related to CLIC3 Antibody (H00009022-M02PE).
 

Pathways for CLIC3 Antibody (H00009022-M02PE)

View related products by pathway.

PTMs for CLIC3 Antibody (H00009022-M02PE)

Learn more about PTMs related to CLIC3 Antibody (H00009022-M02PE).

Blogs on CLIC3

There are no specific blogs for CLIC3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLIC3 Antibody (3F8) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIC3