CLCC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82792] - Staining of human cerebellum, endometrium, kidney and testis using Anti-CLCC1 antibody NBP1-82792 (A) shows similar protein distribution across tissues to independent antibody NBP1-82793 (B).

Immunocytochemistry/Immunofluorescence: CLCC1 Antibody [NBP1-82792] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum & vesicles.

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82792] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82792] - Staining of human cerebellum shows weak positivity in neuronal processes.

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82792] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CLCC1 Antibody [NBP1-82792] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLCC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CLCC1 Antibody - BSA Free (NBP1-82792) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLCC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CLCC1 Protein (NBP1-82792PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLCC1 Antibody - BSA Free

• chloride channel CLIC-like 1
• KIAA0761
• MCLCchloride channel CLIC-like protein 1
• Mid-1-related chloride channel 1
• Mid-1-related chloride channel protein 1
• Mid1-related chloride channel

Background

Chloride channels (CLCs) regulate cellular traffic of chloride ions, a critical component of all living cells. CLCs are involved in membrane potential stabilization, signal transduction, cell volume regulation and organic solute transport. CLCC1 (Chloride channel CLIC-like protein 1), also known as MCLC (Mid-1-related chloride channel) or KIAA0761, is a 551 amino acid multi-pass membrane protein that belongs to the chloride channel MCLC family. CLCC1 is related to the Saccharomyces cerevisiaeprotein Mid-1 and is believed to function as an intracellular chloride channel that is expressed in lung, brain, muscle, liver and testis. Localizing to intracellular compartments such as the Golgi apparatus, the endoplasmic reticulum (ER) and the nuclear envelope, CLCC1 is expressed as four isoforms due to alternative splicing events, namely hMCLC-1, hMCLC-2, hMCLC-3 and hMCLC-4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLCC1