We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Claudin-7 Recombinant Protein Antigen

Images

 
There are currently no images for Claudin-7 Protein (NBP1-85683PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Claudin-7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLDN7.

Source: E. coli

Amino Acid Sequence: PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLDN7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85683.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Claudin-7 Recombinant Protein Antigen

  • CEPTRL2
  • claudin 7
  • claudin-1
  • Claudin7
  • Claudin-7
  • CLDN7
  • CLDN-7
  • clostridium perfringens enterotoxin receptor-like 2
  • CPETRL2

Background

The Claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteins are known to localize to tight junctions, including the Claudins, Occludin and junction adhesion molecule (JAM). Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. Claudin expression is highly restricted to specfic regions of different tissues and may have an important role in transcellular transport through tight junctions. mRNA studies indicate that claudin-7 is specifically expressed in mouse lung and kidney, but not in heart, brain, spleen, liver, skeletal muscle or testis. The gene encoding human claudin-7 maps to chromosome 17p13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87402
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP1-85047
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-41187
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87402
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-92140
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-92846
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-59157
Species: Hu, Po
Applications: IHC,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
MAB3656
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP2-49230
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP1-85683PEP
Species: Hu
Applications: AC

Publications for Claudin-7 Protein (NBP1-85683PEP) (0)

There are no publications for Claudin-7 Protein (NBP1-85683PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-7 Protein (NBP1-85683PEP) (0)

There are no reviews for Claudin-7 Protein (NBP1-85683PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Claudin-7 Protein (NBP1-85683PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Claudin-7 Products

Research Areas for Claudin-7 Protein (NBP1-85683PEP)

Find related products by research area.

Blogs on Claudin-7

There are no specific blogs for Claudin-7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Claudin-7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN7