Claudin-5 Antibody (3D8) [Alexa Fluor® 647]


Sandwich ELISA: Claudin-5 Antibody (3D8) [Alexa Fluor (R) 647] [H00007122-M01AF647] - Detection limit for recombinant GST tagged CLDN5 is approximately 0.1ng/ml as a capture antibody.

Product Details

Product Discontinued
View other related Claudin-5 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Claudin-5 Antibody (3D8) [Alexa Fluor® 647] Summary

CLDN5 (NP_003268, 29 a.a. - 81 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
CLDN5 (3D8)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.



Packaging, Storage & Formulations

Store at -20C in powder form. Store at -80C once reconstituted.
50mM Sodium Borate
0.05% Sodium Azide
IgG purified


Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or

Alternate Names for Claudin-5 Antibody (3D8) [Alexa Fluor® 647]

  • AWAL
  • AWALTransmembrane protein deleted in VCFS
  • BEC1
  • claudin 5
  • Claudin5
  • Claudin-5
  • CLDN5
  • TMVCF1
  • transmembrane protein deleted in velocardiofacial syndrome


This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ELISA

Publications for Claudin-5 Antibody (H00007122-M01AF647) (0)

There are no publications for Claudin-5 Antibody (H00007122-M01AF647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-5 Antibody (H00007122-M01AF647) (0)

There are no reviews for Claudin-5 Antibody (H00007122-M01AF647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Claudin-5 Antibody (H00007122-M01AF647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Claudin-5 Products

Bioinformatics Tool for Claudin-5 Antibody (H00007122-M01AF647)

Discover related pathways, diseases and genes to Claudin-5 Antibody (H00007122-M01AF647). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-5 Antibody (H00007122-M01AF647)

Discover more about diseases related to Claudin-5 Antibody (H00007122-M01AF647).

Pathways for Claudin-5 Antibody (H00007122-M01AF647)

View related products by pathway.

PTMs for Claudin-5 Antibody (H00007122-M01AF647)

Learn more about PTMs related to Claudin-5 Antibody (H00007122-M01AF647).

Research Areas for Claudin-5 Antibody (H00007122-M01AF647)

Find related products by research area.

Blogs on Claudin-5

There are no specific blogs for Claudin-5, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Claudin-5 Antibody (3D8) [Alexa Fluor® 647] and receive a gift card or discount.


Gene Symbol CLDN5