CL-P1/COLEC12 Antibody


Western Blot: CL-P1/COLEC12 Antibody [NBP1-98453] - Antibody Dilution: 1.0ug/ml Sample Tissue: HepG2 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CL-P1/COLEC12 Antibody Summary

The immunogen for this antibody is CLP1 - N-terminal region. Peptide sequence MRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAITSRLADVFNQRCE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CL-P1/COLEC12 Antibody

  • CL-P1
  • CLP1, cleavage and polyadenylation factor I subunit, homolog (S. cerevisiae)
  • COLEC12
  • EC
  • hClp1
  • HEABATP/GTP-binding protein
  • homolog of yeast CFIA subunit Clp1p
  • NSR2
  • Polynucleotide kinase Clp1
  • polyribonucleotide 5'-hydroxyl-kinase Clp1
  • Pre-mRNA cleavage complex II protein Clp1
  • SCARA4
  • SRCL Type I


CLP1 is a polynucleotide kinase that can phosphorylate the 5'-hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Ca, Ch, Eq, Fe, GP, Op, Other, Pm
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB

Publications for CL-P1/COLEC12 Antibody (NBP1-98453) (0)

There are no publications for CL-P1/COLEC12 Antibody (NBP1-98453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CL-P1/COLEC12 Antibody (NBP1-98453) (0)

There are no reviews for CL-P1/COLEC12 Antibody (NBP1-98453). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CL-P1/COLEC12 Antibody (NBP1-98453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CL-P1/COLEC12 Antibody Products

Related Products by Gene

Bioinformatics Tool for CL-P1/COLEC12 Antibody (NBP1-98453)

Discover related pathways, diseases and genes to CL-P1/COLEC12 Antibody (NBP1-98453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CL-P1/COLEC12 Antibody (NBP1-98453)

Discover more about diseases related to CL-P1/COLEC12 Antibody (NBP1-98453).

Pathways for CL-P1/COLEC12 Antibody (NBP1-98453)

View related products by pathway.

PTMs for CL-P1/COLEC12 Antibody (NBP1-98453)

Learn more about PTMs related to CL-P1/COLEC12 Antibody (NBP1-98453).

Blogs on CL-P1/COLEC12

There are no specific blogs for CL-P1/COLEC12, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our CL-P1/COLEC12 Antibody and receive a gift card or discount.


Gene Symbol CLP1

Customers Who Bought This Also Bought