CL-P1/COLEC12 Antibody

Images

 
Western Blot: CL-P1/COLEC12 Antibody [NBP1-98453] - Antibody Dilution: 1.0ug/ml Sample Tissue: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

CL-P1/COLEC12 Antibody Summary

Immunogen
The immunogen for this antibody is CLP1 - N-terminal region. Peptide sequence MRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAITSRLADVFNQRCE.
Clonality
Polyclonal
Host
Rabbit
Gene
CLP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CL-P1/COLEC12 Antibody

  • CLP1, cleavage and polyadenylation factor I subunit, homolog (S. cerevisiae)
  • CL-P1/COLEC12
  • COLEC12
  • EC 2.7.1.78
  • hClp1
  • HEABATP/GTP-binding protein
  • homolog of yeast CFIA subunit Clp1p
  • NSR2
  • Polynucleotide kinase Clp1
  • polyribonucleotide 5'-hydroxyl-kinase Clp1
  • Pre-mRNA cleavage complex II protein Clp1
  • SCARA4
  • SRCL Type I

Background

CLP1 is a polynucleotide kinase that can phosphorylate the 5'-hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP2-12787
Species: Hu
Applications: WB, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
AF888
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27204
Species: Hu, Ca, Ch, Eq, Fe, GP, Op, Other, Pm
Applications: WB, Simple Western
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84621
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31993
Species: Hu
Applications: WB, IHC, IHC-P
H00009098-M01
Species: Hu
Applications: WB, ELISA
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49672
Species: Hu
Applications: IHC
NBP1-98453
Species: Hu
Applications: WB

Publications for CL-P1/COLEC12 Antibody (NBP1-98453) (0)

There are no publications for CL-P1/COLEC12 Antibody (NBP1-98453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CL-P1/COLEC12 Antibody (NBP1-98453) (0)

There are no reviews for CL-P1/COLEC12 Antibody (NBP1-98453). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CL-P1/COLEC12 Antibody (NBP1-98453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CL-P1/COLEC12 Antibody Products

Related Products by Gene

Bioinformatics Tool for CL-P1/COLEC12 Antibody (NBP1-98453)

Discover related pathways, diseases and genes to CL-P1/COLEC12 Antibody (NBP1-98453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CL-P1/COLEC12 Antibody (NBP1-98453)

Discover more about diseases related to CL-P1/COLEC12 Antibody (NBP1-98453).
 

Pathways for CL-P1/COLEC12 Antibody (NBP1-98453)

View related products by pathway.

PTMs for CL-P1/COLEC12 Antibody (NBP1-98453)

Learn more about PTMs related to CL-P1/COLEC12 Antibody (NBP1-98453).

Blogs on CL-P1/COLEC12

There are no specific blogs for CL-P1/COLEC12, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CLP1
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98453 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought