CL-P1/COLEC12 Antibody


Western Blot: CL-P1/COLEC12 Antibody [NBP1-98453] - Antibody Dilution: 1.0ug/ml Sample Tissue: HepG2 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CL-P1/COLEC12 Antibody Summary

The immunogen for this antibody is CLP1 - N-terminal region. Peptide sequence MRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAITSRLADVFNQRCE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CL-P1/COLEC12 Antibody

  • CL-P1
  • CLP1, cleavage and polyadenylation factor I subunit, homolog (S. cerevisiae)
  • COLEC12
  • EC
  • hClp1
  • HEABATP/GTP-binding protein
  • homolog of yeast CFIA subunit Clp1p
  • NSR2
  • Polynucleotide kinase Clp1
  • polyribonucleotide 5'-hydroxyl-kinase Clp1
  • Pre-mRNA cleavage complex II protein Clp1
  • SCARA4
  • SRCL Type I


CLP1 is a polynucleotide kinase that can phosphorylate the 5'-hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB

Publications for CL-P1/COLEC12 Antibody (NBP1-98453) (0)

There are no publications for CL-P1/COLEC12 Antibody (NBP1-98453).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CL-P1/COLEC12 Antibody (NBP1-98453) (0)

There are no reviews for CL-P1/COLEC12 Antibody (NBP1-98453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CL-P1/COLEC12 Antibody (NBP1-98453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CL-P1/COLEC12 Products

Bioinformatics Tool for CL-P1/COLEC12 Antibody (NBP1-98453)

Discover related pathways, diseases and genes to CL-P1/COLEC12 Antibody (NBP1-98453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CL-P1/COLEC12 Antibody (NBP1-98453)

Discover more about diseases related to CL-P1/COLEC12 Antibody (NBP1-98453).

Pathways for CL-P1/COLEC12 Antibody (NBP1-98453)

View related products by pathway.

PTMs for CL-P1/COLEC12 Antibody (NBP1-98453)

Learn more about PTMs related to CL-P1/COLEC12 Antibody (NBP1-98453).

Blogs on CL-P1/COLEC12

There are no specific blogs for CL-P1/COLEC12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CL-P1/COLEC12 Antibody and receive a gift card or discount.


Gene Symbol CLP1