CKS2 Antibody (2H5-2C4) [PerCP]



Product Details

Product Discontinued
View other related CKS2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CKS2 Antibody (2H5-2C4) [PerCP] Summary

CKS2 (AAH06458, 1 a.a. - 79 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
CKS2 - CDC28 protein kinase regulatory subunit 2
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Store at 4C in the dark.
0.05% Sodium Azide
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CKS2 Antibody (2H5-2C4) [PerCP]

  • CDC28 protein kinase 2
  • CDC28 protein kinase regulatory subunit 2
  • CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2
  • CKS-2
  • CKSHS2
  • cyclin-dependent kinases regulatory subunit 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, Flow
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu

Publications for CKS2 Antibody (H00001164-M01PCP) (0)

There are no publications for CKS2 Antibody (H00001164-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKS2 Antibody (H00001164-M01PCP) (0)

There are no reviews for CKS2 Antibody (H00001164-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CKS2 Antibody (H00001164-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CKS2 Products

Bioinformatics Tool for CKS2 Antibody (H00001164-M01PCP)

Discover related pathways, diseases and genes to CKS2 Antibody (H00001164-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKS2 Antibody (H00001164-M01PCP)

Discover more about diseases related to CKS2 Antibody (H00001164-M01PCP).

Pathways for CKS2 Antibody (H00001164-M01PCP)

View related products by pathway.

PTMs for CKS2 Antibody (H00001164-M01PCP)

Learn more about PTMs related to CKS2 Antibody (H00001164-M01PCP).

Research Areas for CKS2 Antibody (H00001164-M01PCP)

Find related products by research area.

Blogs on CKS2

There are no specific blogs for CKS2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CKS2 Antibody (2H5-2C4) [PerCP] and receive a gift card or discount.


Gene Symbol CKS2