CKII alpha prime polypeptide Antibody (4F2) [PerCP]

Images

 

Order Details


    • Catalog Number
      H00001459-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CKII alpha prime polypeptide Antibody (4F2) [PerCP] Summary

Immunogen
CSNK2A2 (AAH08812.1, 1 a.a. - 350 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Specificity
CSNK2A2 (4F2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSNK2A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CKII alpha prime polypeptide Antibody (4F2) [PerCP]

  • casein kinase 2, alpha prime polypeptide
  • casein kinase II subunit alpha'
  • CK II alpha'
  • CK2A2
  • CSNK2A1
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ43934

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-52449
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-35006
Species: Hu
NBP1-89326
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP2-13636
Species: Hu
Applications: IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-91966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00001459-M01PCP
Species: Hu
Applications: ELISA, ICC/IF

Publications for CKII alpha prime polypeptide Antibody (H00001459-M01PCP) (0)

There are no publications for CKII alpha prime polypeptide Antibody (H00001459-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKII alpha prime polypeptide Antibody (H00001459-M01PCP) (0)

There are no reviews for CKII alpha prime polypeptide Antibody (H00001459-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CKII alpha prime polypeptide Antibody (H00001459-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CKII alpha prime polypeptide Products

Bioinformatics Tool for CKII alpha prime polypeptide Antibody (H00001459-M01PCP)

Discover related pathways, diseases and genes to CKII alpha prime polypeptide Antibody (H00001459-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKII alpha prime polypeptide Antibody (H00001459-M01PCP)

Discover more about diseases related to CKII alpha prime polypeptide Antibody (H00001459-M01PCP).
 

Pathways for CKII alpha prime polypeptide Antibody (H00001459-M01PCP)

View related products by pathway.

PTMs for CKII alpha prime polypeptide Antibody (H00001459-M01PCP)

Learn more about PTMs related to CKII alpha prime polypeptide Antibody (H00001459-M01PCP).
 

Research Areas for CKII alpha prime polypeptide Antibody (H00001459-M01PCP)

Find related products by research area.

Blogs on CKII alpha prime polypeptide

There are no specific blogs for CKII alpha prime polypeptide, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKII alpha prime polypeptide Antibody (4F2) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK2A2