CKAP1 Antibody


Western Blot: CKAP1 Antibody [NBP1-74064] - Titration: 1.0 ug/ml Positive Control: Mouse Thymus.

Product Details

Product Discontinued
View other related CKAP1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CKAP1 Antibody Summary

Synthetic peptides corresponding to the N terminal of Tbcb. Immunizing peptide sequence FKCKLELVVGSPASCMELELYGADDKFYSKLDQEDALLGSYPVDDGCRIH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Tbcb and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CKAP1 Antibody

  • CG22Tubulin-specific chaperone B
  • CKAP1MGC14625
  • cytoskeleton associated protein 1
  • Cytoskeleton-associated protein 1Cytoskeleton-associated protein CKAPI
  • tubulin folding cofactor B
  • tubulin-folding cofactor B


Tbcb binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. It may function as a negative regulator of axonal growth.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Fu, GP, Ha, Mk, Pa, Pm, Rb, Xp, Ye
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, CyTOF-ready, Flow-IC, IF
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB

Publications for CKAP1 Antibody (NBP1-74064) (0)

There are no publications for CKAP1 Antibody (NBP1-74064).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKAP1 Antibody (NBP1-74064) (0)

There are no reviews for CKAP1 Antibody (NBP1-74064). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CKAP1 Antibody (NBP1-74064) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CKAP1 Products

Bioinformatics Tool for CKAP1 Antibody (NBP1-74064)

Discover related pathways, diseases and genes to CKAP1 Antibody (NBP1-74064). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKAP1 Antibody (NBP1-74064)

Discover more about diseases related to CKAP1 Antibody (NBP1-74064).

Pathways for CKAP1 Antibody (NBP1-74064)

View related products by pathway.

Blogs on CKAP1

There are no specific blogs for CKAP1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CKAP1 Antibody and receive a gift card or discount.


Gene Symbol TBCB