Recombinant Human CHST14 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CHST14 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 376 of Human CHST14 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFSLFAYPLPNVTKEACQQ

Protein/Peptide Type
Recombinant Protein
Gene
CHST14

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHST14 Protein

  • ATCS
  • carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
  • D4ST-1
  • D4ST1carbohydrate sulfotransferase 14
  • dermatan 4 sulfotransferase 1
  • Dermatan 4-sulfotransferase 1
  • EC 2.8.2.-
  • HD4ST
  • hD4ST1
  • HNK1ST

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
AF2567
Species: Mu
Applications: WB, IHC
NB110-8146
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
H00113189-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for CHST14 Recombinant Protein (H00113189-P01) (0)

There are no publications for CHST14 Recombinant Protein (H00113189-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHST14 Recombinant Protein (H00113189-P01) (0)

There are no reviews for CHST14 Recombinant Protein (H00113189-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHST14 Recombinant Protein (H00113189-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHST14 Products

CHST14 H00113189-P01

Bioinformatics Tool for CHST14 Recombinant Protein (H00113189-P01)

Discover related pathways, diseases and genes to CHST14 Recombinant Protein (H00113189-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHST14 Recombinant Protein (H00113189-P01)

Discover more about diseases related to CHST14 Recombinant Protein (H00113189-P01).
 

Pathways for CHST14 Recombinant Protein (H00113189-P01)

View related products by pathway.

PTMs for CHST14 Recombinant Protein (H00113189-P01)

Learn more about PTMs related to CHST14 Recombinant Protein (H00113189-P01).
 

Research Areas for CHST14 Recombinant Protein (H00113189-P01)

Find related products by research area.

Blogs on CHST14

There are no specific blogs for CHST14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CHST14 Antibody
NBP2-57389

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHST14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST14