Recombinant Human Chromogranin A Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Chromogranin A Peptides and Proteins

Order Details


    • Catalog Number
      H00001113-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Chromogranin A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-95 of Human CHGA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
CHGA

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Chromogranin A Protein

  • betagranin (N-terminal fragment of chromogranin A)
  • Betagranin
  • Catestatin
  • CGA
  • CHGA
  • Chromofungin
  • chromogranin A (parathyroid secretory protein 1)
  • Chromogranin A
  • chromogranin-A
  • Pancreastatin
  • Parastatin
  • Parathyroid Secretory Protein 1
  • Pituitary Secretory Protein I
  • SP-I

Background

CHGA - chromogranin A (parathyroid secretory protein 1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-35213
Species: Hu
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00001113-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Chromogranin A Partial Recombinant Protein (H00001113-Q01) (0)

There are no publications for Chromogranin A Partial Recombinant Protein (H00001113-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chromogranin A Partial Recombinant Protein (H00001113-Q01) (0)

There are no reviews for Chromogranin A Partial Recombinant Protein (H00001113-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chromogranin A Partial Recombinant Protein (H00001113-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I have following question about antibodies against Chromogranin A. Your products list the species but canine is not included. Does it mean that the products cannot be used on canine tissues?
    • When we do not list a species, it means we have not tested an antibody to work with those samples. If we test an antibody and find that it does not work, we will list the species with a minus sign. Unfortunately, we haven't tried these abs on canine tissues and they may work, but we cannot guarantee it. If you would like to purchase one to try, you will be eligible for the Innovators Reward Program.

Additional Chromogranin A Products

Bioinformatics Tool for Chromogranin A Partial Recombinant Protein (H00001113-Q01)

Discover related pathways, diseases and genes to Chromogranin A Partial Recombinant Protein (H00001113-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chromogranin A Partial Recombinant Protein (H00001113-Q01)

Discover more about diseases related to Chromogranin A Partial Recombinant Protein (H00001113-Q01).
 

Pathways for Chromogranin A Partial Recombinant Protein (H00001113-Q01)

View related products by pathway.

PTMs for Chromogranin A Partial Recombinant Protein (H00001113-Q01)

Learn more about PTMs related to Chromogranin A Partial Recombinant Protein (H00001113-Q01).
 

Research Areas for Chromogranin A Partial Recombinant Protein (H00001113-Q01)

Find related products by research area.

Blogs on Chromogranin A.

Beta Tubulin III and neurogenesis
Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Chromogranin A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHGA
Entrez