| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CHREBP Antibody - BSA Free (NBP2-92977) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 17-175 of human MLXIPL (NP_116569.1). VAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MLXIPL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CHREBP Antibody (NBP2-92977)Find related products by research area.
|
|
Deficiency of GluT1 leads to neurological problems while excess is involved in cancers By Jamshed Arslan, Pharm. D., PhD. What Are GluTs?Mammalian cell metabolism is incomplete without glucose . Glucose is a monosaccharide that is transported to the cells through facilitative diffusion, a ... Read full blog post. |
|
Insulin signaling in adipocytes: Carbohydrate-signaling transcription factor ChREBP is the link between lipolytic enzyme Hormone-Sensitive Lipase and lipogenic enzyme ELOVL6 By Jamshed Arslan, Pharm. D., PhD. Insulin resistance in adipocytes is a major feature of metabolic syndrome . Disrupted adipose tissue metabolism can lead to accumulation of lipid intermediates in insul... Read full blog post. |
|
ChREBP, a glucose sensitive transcription factor with role in glucose-lipids homeostasis and cancer ChREBP (carbohydrate response element-binding protein) is a glucose responsive basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that binds MLX and then carbohydrate response element /ChoRE for the induction of genes involved in ... Read full blog post. |
|
ChREBP and Fatty Acid Biosynthesis Regulation Carbohydrate response element binding protein (ChREBP) is a transcription factor involved in activating genes that encode enzymes of fatty acid biosynthesis in liver and adipose. It is believed to be a key controller of hepatic lipogenesis and has a p... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MLXIPL |