Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen

Order Details


    • Catalog Number
      NBP2-54684PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Chorionic Gonadotropin beta Chain (HCG beta)

Source: E. coli

Amino Acid Sequence: PTMTRVLQGVLPALPQVVCNYRDVRFESIRLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CGB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54684.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen

  • CGB
  • CGB3
  • CGB3choriogonadotropin subunit beta
  • CGB5
  • CGB7
  • CGB8
  • CG-Beta
  • Choriogonadotropin Subunit Beta
  • Chorionic gonadotrophin chain beta
  • chorionic gonadotropin beta 3 subunit
  • Chorionic Gonadotropin beta Chain
  • chorionic gonadotropin beta subunit
  • chorionic gonadotropin, beta polypeptide
  • hCGB

Background

Human chorionic gonadotropin (hCG) is a glycoprotein hormone produced by trophoblastic cells of the placenta beginning 10 to 12 days after conception. Maintenance of the fetus in the first trimester of pregnancy requires the production of hCG, which binds to the corpus luteum of the ovary which is stimulated to produce progesterone which in turn maintains the secretory endometrium. hCG is present only in trace amounts in non pregnant urine and sera. It rises sharply during pregnancy. HCG is composed of two non identical, non covalently linked polypeptide chains designated as the a and b subunits. The a subunit of HCG is nearly identical to that of thyroid stimulating hormone (TSH), follicle stimulating hormone (FSH) and luteinizing hormone (LH). A germ cell tumor which is positive for cytokeratin, placental alkaline phosphatase (PLAP) and HCG but negative for EMA and AFP is probably a choriocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80782
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4065
Species: Mu
Applications: IHC, WB
KA2332
Species: Mu, Rt
Applications: ELISA, QFN
MAB4169
Species: Hu
Applications: IHC, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33498
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00114336-M02
Species: Hu
Applications: ELISA, WB
NBP2-00521
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NB100-55735
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB
NBP3-35061
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
DY523B-05
Species: Hu
Applications: ELISA
NBP2-46477
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-62693
Species: Hu
Applications: IHC,  IHC-P
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP3-35390
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-53210
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-46376
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-54684PEP
Species: Hu
Applications: AC

Publications for Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen (NBP2-54684PEP) (0)

There are no publications for Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen (NBP2-54684PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen (NBP2-54684PEP) (0)

There are no reviews for Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen (NBP2-54684PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen (NBP2-54684PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Chorionic Gonadotropin beta Chain (hCG beta) Products

Research Areas for Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen (NBP2-54684PEP)

Find related products by research area.

Blogs on Chorionic Gonadotropin beta Chain (hCG beta)

There are no specific blogs for Chorionic Gonadotropin beta Chain (hCG beta), but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Chorionic Gonadotropin beta Chain (hCG beta) Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CGB3