CHORDC1 Antibody

Images

 
Western Blot: CHORDC1 Antibody [NBP1-56770] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related CHORDC1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56770
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CHORDC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CHORDC1(cysteine and histidine-rich domain (CHORD)-containing 1) The peptide sequence was selected from the middle region of CHORDC1. Peptide sequence SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHORDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CHORDC1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHORDC1 Antibody

  • CHORD domain-containing protein 1
  • CHORD-containing protein 1
  • CHP1CHP-1
  • cysteine and histidine-rich domain (CHORD) containing 1
  • cysteine and histidine-rich domain (CHORD)-containing 1
  • cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1
  • cysteine and histidine-rich domain-containing protein 1
  • FLJ37289
  • Protein morgana

Background

CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-06467
Species: Hu
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-55149
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13426
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006449-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-33278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3635
Species: Mu
Applications: WB, IHC
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-52420
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91823
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CHORDC1 Antibody (NBP1-56770) (0)

There are no publications for CHORDC1 Antibody (NBP1-56770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHORDC1 Antibody (NBP1-56770) (0)

There are no reviews for CHORDC1 Antibody (NBP1-56770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHORDC1 Antibody (NBP1-56770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CHORDC1 Products

Bioinformatics Tool for CHORDC1 Antibody (NBP1-56770)

Discover related pathways, diseases and genes to CHORDC1 Antibody (NBP1-56770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CHORDC1 Antibody (NBP1-56770)

View related products by pathway.

Blogs on CHORDC1

There are no specific blogs for CHORDC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHORDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHORDC1
Uniprot