Recombinant Human CHL-1/L1CAM-2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CHL-1/L1CAM-2 Peptides and Proteins

Order Details


    • Catalog Number
      H00010752-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CHL-1/L1CAM-2 Protein Summary

Description
CHL-1/L1CAM-2 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CHL1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHL-1/L1CAM-2 Protein

  • CALL
  • CALLClose homolog of L1
  • cell adhesion molecule with homology to L1CAM (close homolog of L1)
  • cell adhesion molecule with homology to L1CAM (close homologue of L1)
  • CHL1
  • CHL-1
  • FLJ44930
  • L1CAM-2
  • L1CAM2L1 cell adhesion molecule 2
  • MGC132578
  • neural cell adhesion molecule L1-like protein

Background

CHL1 - cell adhesion molecule with homology to L1CAM (close homolog of L1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5890
Species: Mu
Applications: WB, Simple Western, IHC
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF5495
Species: Mu
Applications: WB, IHC
H00004782-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-87957
Species: Hu
Applications: IHC, IHC-P
AF2034
Species: Hu
Applications: WB, IHC
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-81000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81406
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15039
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-83242
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
PP-H8132-00
Species: Hu
Applications: WB, IHC, IP
NBP1-03346
Species: Hu
Applications: WB, IHC-P, IP, PLA
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready

Publications for CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01) (0)

There are no publications for CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01) (0)

There are no reviews for CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHL-1/L1CAM-2 Products

Bioinformatics Tool for CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01)

Discover related pathways, diseases and genes to CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01)

Discover more about diseases related to CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01).
 

Pathways for CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01)

View related products by pathway.

PTMs for CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01)

Learn more about PTMs related to CHL-1/L1CAM-2 Partial Recombinant Protein (H00010752-Q01).

Blogs on CHL-1/L1CAM-2

There are no specific blogs for CHL-1/L1CAM-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHL-1/L1CAM-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHL1
Entrez