Recombinant Human Chk1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Chk1 Peptides and Proteins

Order Details


    • Catalog Number
      H00001111-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Chk1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-116 of Human CHEK1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CHEK1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Chk1 Protein

  • Checkpoint, S. pombe, homolog of, 1
  • CHEK1
  • CHK1 (checkpoint, S.pombe) homolog
  • CHK1 checkpoint homolog (S. pombe)
  • Chk1
  • CHK1serine/threonine-protein kinase Chk1
  • EC 2.7.11
  • EC 2.7.11.1

Background

CHEK1 - CHK1 checkpoint homolog (S. pombe)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
MAB1648
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P

Publications for Chk1 Partial Recombinant Protein (H00001111-Q01) (0)

There are no publications for Chk1 Partial Recombinant Protein (H00001111-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chk1 Partial Recombinant Protein (H00001111-Q01) (0)

There are no reviews for Chk1 Partial Recombinant Protein (H00001111-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chk1 Partial Recombinant Protein (H00001111-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Chk1 Products

Bioinformatics Tool for Chk1 Partial Recombinant Protein (H00001111-Q01)

Discover related pathways, diseases and genes to Chk1 Partial Recombinant Protein (H00001111-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chk1 Partial Recombinant Protein (H00001111-Q01)

Discover more about diseases related to Chk1 Partial Recombinant Protein (H00001111-Q01).
 

Pathways for Chk1 Partial Recombinant Protein (H00001111-Q01)

View related products by pathway.

PTMs for Chk1 Partial Recombinant Protein (H00001111-Q01)

Learn more about PTMs related to Chk1 Partial Recombinant Protein (H00001111-Q01).
 

Research Areas for Chk1 Partial Recombinant Protein (H00001111-Q01)

Find related products by research area.

Blogs on Chk1

There are no specific blogs for Chk1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Chk1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHEK1
Entrez