Chk1 Antibody (2G3) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related Chk1 Primary Antibodies

Order Details


    • Catalog Number
      H00001111-M05PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Chk1 Antibody (2G3) [PE] Summary

Immunogen
CHEK1 (AAH04202 361 a.a. - 476 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT
Specificity
CHEK1 (2G3)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHEK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Chk1 Antibody (2G3) [PE]

  • Checkpoint, S. pombe, homolog of, 1
  • CHEK1
  • CHK1 (checkpoint, S.pombe) homolog
  • CHK1 checkpoint homolog (S. pombe)
  • Chk1
  • CHK1serine/threonine-protein kinase Chk1
  • EC 2.7.11
  • EC 2.7.11.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
MAB1648
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P

Publications for Chk1 Antibody (H00001111-M05PE) (0)

There are no publications for Chk1 Antibody (H00001111-M05PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chk1 Antibody (H00001111-M05PE) (0)

There are no reviews for Chk1 Antibody (H00001111-M05PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Chk1 Antibody (H00001111-M05PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Chk1 Products

Bioinformatics Tool for Chk1 Antibody (H00001111-M05PE)

Discover related pathways, diseases and genes to Chk1 Antibody (H00001111-M05PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chk1 Antibody (H00001111-M05PE)

Discover more about diseases related to Chk1 Antibody (H00001111-M05PE).
 

Pathways for Chk1 Antibody (H00001111-M05PE)

View related products by pathway.

PTMs for Chk1 Antibody (H00001111-M05PE)

Learn more about PTMs related to Chk1 Antibody (H00001111-M05PE).
 

Research Areas for Chk1 Antibody (H00001111-M05PE)

Find related products by research area.

Blogs on Chk1

There are no specific blogs for Chk1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chk1 Antibody (2G3) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol CHEK1
Entrez